PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G027400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family BBR-BPC
Protein Properties Length: 331aa    MW: 36624.2 Da    PI: 10.0008
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G027400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind379.94.1e-11613301301
           GAGA_bind   1 mdddgsre..rnkg.yye........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnk 80 
                         md+ g+re  r+++ +y+        p++++k++ +++l+++++erd++i er++al+ekkaa+aerdmaf+qrd+a+ ern+a+verdn+
  Brast07G027400.1.p   1 MDNLGHREngRQRPdQYKglhtqwmiPQRQMKDHHSMNLLALMSERDNAIMERDHALAEKKAAMAERDMAFAQRDSAMVERNAAIVERDNA 91 
                         9999*99999****9*********99889************************************************************** PP

           GAGA_bind  81 llalllvensla...salpvgvqvlsgtksidslqqlse.....pqledsave.lreeeklealpieeaa.eeakekkkkkkrqrakkpke 161
                         l+al+l++++     s +++  ++lsgtk+ ++++qls+     +ql+ds+++  re++++ea+pi+ a   +a ++k++kk++++++p +
  Brast07G027400.1.p  92 LAALELARTNGFnvnSGNGFPPGSLSGTKNFHHHDQLSHaqsspRQLADSPYDhSREMHISEAYPISVASgGNAGKAKRSKKNSSQASPMK 182
                         ****999887665668889999**************888899999********99***********9876257788999999999999999 PP

           GAGA_bind 162 kkak..kkkkksekskkkvkkesader......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPL 244
                         + +   +k+kk + ++++v +++  e+      +k+e+k++dl+ln+v++Des++P+P CsCtG+lrqCYkWGnGGWqS+CCt+++S+yPL
  Brast07G027400.1.p 183 RPSGvlRKTKKATGDWRDVGMSGGGEDparesvMKNEWKDQDLGLNQVAYDESSMPAPSCSCTGKLRQCYKWGNGGWQSSCCTMSMSMYPL 273
                         999888778889999****99986655677888********************************************************** PP

           GAGA_bind 245 PvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         Pv++++r+aR++grKmS++af+klL++La+eG+dls+ vDLkdhWAkHGtn+++tir
  Brast07G027400.1.p 274 PVMPNKRHARMGGRKMSGSAFTKLLSRLAGEGHDLSTSVDLKDHWAKHGTNRYITIR 330
                         ********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.6E-1541330IPR010409GAGA-binding transcriptional activator
PfamPF062177.6E-961330IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MDNLGHRENG RQRPDQYKGL HTQWMIPQRQ MKDHHSMNLL ALMSERDNAI MERDHALAEK  60
KAAMAERDMA FAQRDSAMVE RNAAIVERDN ALAALELART NGFNVNSGNG FPPGSLSGTK  120
NFHHHDQLSH AQSSPRQLAD SPYDHSREMH ISEAYPISVA SGGNAGKAKR SKKNSSQASP  180
MKRPSGVLRK TKKATGDWRD VGMSGGGEDP ARESVMKNEW KDQDLGLNQV AYDESSMPAP  240
SCSCTGKLRQ CYKWGNGGWQ SSCCTMSMSM YPLPVMPNKR HARMGGRKMS GSAFTKLLSR  300
LAGEGHDLST SVDLKDHWAK HGTNRYITIR *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228061.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_003557130.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_010228062.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_010228060.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_010228063.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_010228059.10.0PREDICTED: barley B recombinant-like protein D
SwissprotQ5VSA80.0BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLI1H1910.0I1H191_BRADI; Uncharacterized protein
STRINGBRADI1G49980.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62263756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-100basic pentacysteine 6