PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G229100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TCP
Protein Properties Length: 411aa    MW: 43283.1 Da    PI: 10.132
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G229100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.92.5e-36621803123
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaks 93 
                         g+kdrhsk++T++g RdRRvRls+ +a++f+dLqd+LG+d++sk++eWL+++a +ai++l+++++s+   + ++ss+ ++  ++ +++ + 
  Brast06G229100.1.p  62 GGKDRHSKVYTAKGIRDRRVRLSVATAIQFYDLQDRLGYDQPSKAVEWLIKAAAAAIDKLPSLDASAF-PSHPASSKPQQ--PQPQQQLTR 149
                         78*************************************************************33322.22233333333..333455677 PP

                 TCP  94 aakskksqksaasalnlak.esrakararar 123
                         + +s+ s++s+ s+l+l++ +sr kar r+ 
  Brast06G229100.1.p 150 SGCSSTSETSKGSVLSLSRsDSRVKARDRSA 180
                         7799999999999999999999999999954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.5E-3562175IPR005333Transcription factor, TCP
PROSITE profilePS5136932.11263121IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MDLVVPGGAG DRKRGREPEE DDEDGASEEQ RRQAGEAKQQ RRAAPQQQNP ASRIYRVSRG  60
SGGKDRHSKV YTAKGIRDRR VRLSVATAIQ FYDLQDRLGY DQPSKAVEWL IKAAAAAIDK  120
LPSLDASAFP SHPASSKPQQ PQPQQQLTRS GCSSTSETSK GSVLSLSRSD SRVKARDRSA  180
ASALAAPGRP RATAAATSAQ AASFTELLTG LAAAATPPAA ADHKPPPTPQ HGSWPATADY  240
LGFAQPRKPG HGMLHAAFAS PAPHLANIAP IAMAAPTQHF SLTSAEPQAD MAPFSFLQDH  300
FMPVHAAAAA AGPAAVDYNL NFSMSSGLVG ANSRGTLQSN SQPHLSSHHQ QQLQRLAAPL  360
DASHIPFFFS PAVTVASPNA AEGHFASAAA AAFQLWDGFR HSDVKEKGKN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-2668122155Putative transcription factor PCF6
5zkt_B4e-2668122155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00639PBMTransfer from Lj6g3v1946420Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G229100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557649.20.0transcription factor PCF6
SwissprotQ10CE83e-76PCF6_ORYSJ; Transcription factor PCF6
TrEMBLA0A0Q3K9C90.0A0A0Q3K9C9_BRADI; Uncharacterized protein
STRINGBRADI1G58450.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30943271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.26e-38TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2