PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G225400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 169aa    MW: 19055.6 Da    PI: 5.7522
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G225400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF39.76e-131461249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                         i+n++ r ++f kRr g++K     SvL++a+vav++    gk++ +
  Brast06G225400.1.p 14 YIDNDRERDISFYKRRSGLFKGVTDFSVLTGARVAVVLETGIGKMHSF 61
                        59******************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-9164IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.213565IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-9727IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.89E-16875IPR002100Transcription factor, MADS-box
CDDcd001201.63E-13864No hitNo description
PfamPF003194.2E-151561IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-92742IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-94263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MGRLRREKRL GVQYIDNDRE RDISFYKRRS GLFKGVTDFS VLTGARVAVV LETGIGKMHS  60
FGTPSADPIV DAFLSGNPPI GPLTDEVTNA SIAWLQDEVA RLDMENTMEE NKTKLSIQDT  120
KKIQGENPGM VANFIFSKQE DLSLQDLIQL FNEHSRVQEV IERHPSYGK
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G225400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693490.0KF469349.1 Brachypodium distachyon MADS-box transcription factor 55 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228419.11e-103agamous-like MADS-box protein AGL62
TrEMBLA0A2K2DS751e-102A0A2K2DS75_BRADI; Uncharacterized protein (Fragment)
STRINGBRADI1G58100.11e-103(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30892276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-12AGAMOUS-like 62