PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G225200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 969aa    MW: 106694 Da    PI: 8.2247
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G225200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.74.7e-07298389146
                         TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwq 45 
                         +++W+  E + l+++vkq   +                                              +W++Ia++   gR++ +c srw+
  Brast06G225200.1.p 298 KQSWSDMEKDSLAKGVKQQYQEiliknsmkngsstgdfsaldiacamtntagnfevppeilrsvlplvNWDKIAAMYLPGRSGAECESRWL 388
                         689***************9999****************************************************99888***********9 PP

                         H CS
     Myb_DNA-binding  46 k 46 
                         +
  Brast06G225200.1.p 389 N 389
                         8 PP

2Myb_DNA-binding24.56.2e-08398442246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++WT+ E++ l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
  Brast06G225200.1.p 398 NAWTASEEKTLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 442
                         58*****************************99**********96 PP

3Myb_DNA-binding43.38.2e-14451495248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           WT+eEd++l+ av+ +G + W ++++ +  gR ++qc +rw+k l
  Brast06G225200.1.p 451 RVWTKEEDLQLLAAVETFGCN-WQLVSASLD-GRIGNQCSNRWRKTL 495
                         57*****************88.*********.************975 PP

4Myb_DNA-binding42.71.3e-13503548248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         grW+++Ed++l   vk++G+g+W +I++ ++ gRt  qc +rw+++l
  Brast06G225200.1.p 503 GRWSEDEDKRLMVSVKLFGSGSWIKISQFVP-GRTQSQCSERWRNVL 548
                         8******************************.************986 PP

5Myb_DNA-binding32.32.3e-10555598246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g W +eEd +l+  v++ G   W++Ia  m  +Rt+++c  rw  
  Brast06G225200.1.p 555 GDWRPEEDSKLLASVHEVGAC-WSKIAGAMIPRRTDNMCLRRWKR 598
                         78*****************99.*****99999***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.144293391IPR017877Myb-like domain
SMARTSM007170.0013297393IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-10300316IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-10363404IPR009057Homeodomain-like
CDDcd001670.00221366390No hitNo description
SuperFamilySSF466891.72E-5366409IPR009057Homeodomain-like
PROSITE profilePS500908.56392444IPR017877Myb-like domain
SMARTSM007175.9E-5396446IPR001005SANT/Myb domain
SuperFamilySSF466891.04E-20396491IPR009057Homeodomain-like
PfamPF139215.5E-7400448No hitNo description
Gene3DG3DSA:1.10.10.607.9E-13405451IPR009057Homeodomain-like
PROSITE profilePS5129419.983445499IPR017930Myb domain
SMARTSM007173.2E-12449497IPR001005SANT/Myb domain
PfamPF002492.7E-12451494IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-15452495IPR009057Homeodomain-like
CDDcd001671.24E-9453495No hitNo description
PROSITE profilePS5009010.731497548IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.6E-18499550IPR009057Homeodomain-like
SMARTSM007171.1E-10501550IPR001005SANT/Myb domain
SuperFamilySSF466894.58E-24501596IPR009057Homeodomain-like
PfamPF002495.7E-13503548IPR001005SANT/Myb domain
CDDcd001672.72E-10504548No hitNo description
PROSITE profilePS5129416.642549604IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-15551602IPR009057Homeodomain-like
SMARTSM007171.1E-8553602IPR001005SANT/Myb domain
PfamPF002497.9E-9555598IPR001005SANT/Myb domain
CDDcd001673.30E-8557599No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 969 aa     Download sequence    Send to blast
MDLYSDDDSD PEFDEGLQED LDLVRRSCIA AGADPDAAAG RVSSYLATPS APSSAAALPA  60
AAGDGLSDDD EDEDEDEDED LALVRSIREH LHLNKASPSS PLPSEPRPIC VWPPSDTDDD  120
DEDDLETLRA IQRRFSHYQA GTSTGPPENM KNETSKVGGD EFIAHQPAEE DVEKQNPKAL  180
NRTQFPKAAL LLVDALKKNR ACQKLIRRKM INIEAKIEVN KDLRDRVKCL MDYQLGCRRS  240
FGRFLCQKVD PRVRLISSRK PSAQSEKKMS ALLHGPAENL HVSKYKAVLK QFPVSLQKQS  300
WSDMEKDSLA KGVKQQYQEI LIKNSMKNGS STGDFSALDI ACAMTNTAGN FEVPPEILRS  360
VLPLVNWDKI AAMYLPGRSG AECESRWLNV DDPLINNNAW TASEEKTLIL TVQEKGMHNW  420
INIAVALGTQ RTPFQCLARY QRSLNPHILK RVWTKEEDLQ LLAAVETFGC NWQLVSASLD  480
GRIGNQCSNR WRKTLLPERT RVGRWSEDED KRLMVSVKLF GSGSWIKISQ FVPGRTQSQC  540
SERWRNVLDP DIDHGDWRPE EDSKLLASVH EVGACWSKIA GAMIPRRTDN MCLRRWKRLC  600
QDEVPRVIAT NQVKKSIFQT NFVDRETERP AIGPSDFPLL VYSKVDRGDG NTASDQVKKR  660
SRGTCKNNLP ASDPSKSSAD VAAVNTTTRK SRKKLSGSGS EMQTGEDIAV SNGVNKSSSG  720
HSRARKRKSN NGNTAVVQKR MRGSISFDNV ASLDILGGPS GIDNEAPRSV GKEGTSEKRT  780
NGFMSAGNEG TLKKKMRGSI SVGDERAAKN KARGSVPIGN EGNTMKRKRV TRKSAKDNSA  840
ADMVDACELD LPALLSEASV ERDVDTGNVN KMKRKSTPRP RRINIAEGTA DEYSRLADCL  900
SFARRNGTSR NKSCSMGSLN NAMQSNGPSG ENLQGSTVTI SAGPDPIPVE NGSNAKLAAN  960
DYETIIEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-253696213159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-253696213159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752712.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X3
TrEMBLA0A0Q3S7D70.0A0A0Q3S7D7_BRADI; Uncharacterized protein
STRINGBRADI1G58087.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-139myb domain protein 4r1