PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G222900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 369aa    MW: 40622.7 Da    PI: 4.4653
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G222900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.75.2e-121864349
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        i +++ r +tf kRr g++K A  L  L++a+vavi+ + +g+++ +
  Brast06G222900.1.p 18 IGDNRARDITFYKRRGGLFKSATDLYSLTNARVAVILEADNGRMHSF 64
                        678899***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-7167IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.722868IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-81030IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-131178IPR002100Transcription factor, MADS-box
PfamPF003193.8E-151864IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-83045IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-84566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MLRGRVPRRE RRLGVQYIGD NRARDITFYK RRGGLFKSAT DLYSLTNARV AVILEADNGR  60
MHSFGTPLAD PIVDAFLSGE PPIEPLTDQA TSDRIALLQN EVARLDMENT MEVSKAKLTT  120
KRIKEIQDEN PGMGANLLLS RKEDLNLEDL TKMFNELSCV EQNIARRVPP LNRVHEQNGP  180
SMFANHPPPQ VPSWGLMANL PSPPHSSSSD LLMDLLLQQE QPVPPVPIPS APQLVWAPNF  240
PVQVPDTLQP PMPAAMSPPI LNQVQELPSP LQPNLASHDN VVEPPQNNTN PNSIFEPSEE  300
ASPLLVNTGG NNFDIDDPFG YEHWSYDLPY YSSFLEMLGS DVGQAEMGNG GWVNAPPESS  360
SDRGNASN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G222900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230083.10.0floral homeotic protein GLOBOSA
TrEMBLI1H3V60.0I1H3V6_BRADI; Uncharacterized protein
STRINGBRADI1G57870.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30892276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-11AGAMOUS-like 62