PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G218100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 353aa    MW: 39323.5 Da    PI: 6.6856
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G218100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.52e-141359349
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        ien+ +r+vtfskRr g++K A+ L v ++a+va+++   + k++ +
  Brast06G218100.1.p 13 IENDDQRSVTFSKRRLGLFKGASDLAVVTGARVAIVLETDSRKMHSF 59
                        9*************************************999999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-10162IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.787363IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-8525IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-15672IPR002100Transcription factor, MADS-box
PfamPF003192.0E-171359IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-82540IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-84061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MPRRERRSGV VYIENDDQRS VTFSKRRLGL FKGASDLAVV TGARVAIVLE TDSRKMHSFG  60
TPSADPIIDA LLSGVPPPEP LTDEAKKIRI SWLQGEVSRL DRENNTEEKK KKNFVQRIKE  120
IQQVNPVMVA NHLFSKDEDL SLEDMTKLFN ELLHFEQGTG SRLPPLDHGH EQMTGGSSVP  180
QNLVPPSSAP SWGSAETPPL LLHPLGSHQL SHQPLPPILP PSVPQNMLAP PFPVQVPLML  240
RPTPLASTPA TPSPYQLHEL PPSLDQLPLQ NYTKLCKTAS PYNTKETPES NRSTNSTFEH  300
NVEDSLFLVY SSGNGFAVDD LFGYDQGTYV LSGRPYYKRF LETIGYLRYY STG
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G218100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693480.0KF469348.1 Brachypodium distachyon MADS-box transcription factor 54 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230074.11e-179transcription factor RLM1
TrEMBLI1H3Q71e-169I1H3Q7_BRADI; MADS-box transcription factor 54
STRINGBRADI1G57420.11e-179(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30892276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-14AGAMOUS-like 62