PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G198400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CPP
Protein Properties Length: 787aa    MW: 84560.2 Da    PI: 7.0283
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G198400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.21.1e-15472510240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+C+CkkskClk+YCeCfaag++Cse C+C +C Nk 
  Brast06G198400.1.p 472 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCLGCLNKP 510
                         689**********************************96 PP

2TCR50.54e-16557595139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+
  Brast06G198400.1.p 557 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNT 595
                         589***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.6E-17471512IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.102472597IPR005172CRC domain
PfamPF036381.2E-11474509IPR005172CRC domain
SMARTSM011141.3E-15557598IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11559595IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MDTPDRAAAP ASSRAEDSPL FGFIDSLSPI EPLKSAYSTN SLQGYQSLSI TSISSIFTSP  60
HHNTQKESKL SKSSFADFTE SEVCTDHSDK NKPPSSSNAV RLFACTSSST QETHTVTRSV  120
HEGIVDPPKG PNDLPQPGRF ESGSPDHNTT PCHGVRSDLK QDKRRKTEAV PTTKNTLENR  180
KCLFSSNIQL PDGCQPEKGN GEVLGCDWED LVSATSGELL AFDDSSNVED HRGVHLAVNN  240
AESCGFLLSE LNGGCDISDR THPIGTSQAY YHEMVMEEDK TESAQFFSEG QKTMSAEEMQ  300
GNLNGDNACI PLGCKVETQQ QRGTRKRCLV FEAGGYSSRT VQNESVGDLT VSKLKGKSVA  360
QNHANPGKTP SPRVLRGIGL HLNALALTSK DKIVCQDPLA TALVPSVKTE QDMHGNLLSA  420
GENFIHSGGE LLDLQMDNDD CLAGGLGNDH ISSQSSSPQK KRRKSDNGDD ESCKRCSCKK  480
SKCLKLYCEC FAAGVYCSEP CSCLGCLNKP IHEEIVLSTR KQIEFRNPLA FAPKVIRLSD  540
AGQETQEDPN NTPASARHKR GCNCKKSSCL KKYCECYQGG VGCSSNCRCE SCKNTFGMRD  600
GAVSAENEEM KQGGEQAESC GKEKENDKQK ANVHNGDHQL VELVVPITPP LAISSSSLQQ  660
PNFSNAKPPR PSKPRTGSSS RPSKAAESVH SRKIPKVANS VFNEEMPDIL TEPASPGIVK  720
TSSPNGKRVS PPHNALSISP SRRGGRKLIL KSIPSFPSLL GDTSSGSAMS NSNSTFTESS  780
LALGPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1647459412120Protein lin-54 homolog
5fd3_B6e-1647459412120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158164LKQDKRR
2459463KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G198400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557490.10.0protein tesmin/TSO1-like CXC 2
TrEMBLI1H3640.0I1H364_BRADI; Uncharacterized protein
STRINGBRADI1G55710.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-77TESMIN/TSO1-like CXC 2