PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G192500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 244aa    MW: 26611.4 Da    PI: 9.1685
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G192500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.61.9e-14954146
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                        +ri n+  r   f kR n + KKA ELS+LC+++v+v+++++   l
  Brast06G192500.1.p  9 ERIPNDVARRAAFRKRVNRLTKKAGELSTLCNTKVCVLVYAEGEAL 54
                        6899************************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.096156IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-11160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-16394IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-7323IPR002100Transcription factor, MADS-box
CDDcd002665.07E-17382No hitNo description
PfamPF003194.7E-131050IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MPRKHTTVER IPNDVARRAA FRKRVNRLTK KAGELSTLCN TKVCVLVYAE GEALPEVYPS  60
VAQAVPLLQR FKGTPEIDQY KKTVTQEDFL RQRMDRLKLQ IQKTAPENCE RDTAILLHQA  120
IAGRLQGGLE GLAPEKSDSV RWMVQMRLKS IGELIAKRQA QAEAALQLQS LPAPVPPPPY  180
QQDEASQKEI ISTVNEVRSD GDLGTIVFSG ISGGDGAGAN TSTGAGFSWQ WDLGASSSSM  240
PPM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G192500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228259.21e-117agamous-like MADS-box protein AGL80
TrEMBLA0A0Q3HCA81e-115A0A0Q3HCA8_BRADI; Uncharacterized protein
STRINGBRADI1G55040.16e-55(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.24e-19M-type_MADS family protein