PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G187000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 260aa    MW: 28460.8 Da    PI: 6.2866
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G187000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.6e-1260104549
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                         k+ +r+++NR++ArrsR +K  ++++L+     LeaeNk L    
  Brast06G187000.1.p  60 KVKKRRESNRISARRSRYKKATQMQNLQHQLSLLEAENKYLVRHQ 104
                         899***********************************9986544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-1056120IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9958114IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-859109No hitNo description
PfamPF001701.2E-860103IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.13E-960111No hitNo description
CDDcd146868.97E-1162110No hitNo description
PROSITE patternPS0003606378IPR004827Basic-leucine zipper domain
PfamPF124981.1E-23127234IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MPVQQMSGGG QYGGTSPNLA QNPDVGVRQV SSPLREQSPS TNNIEGEAET MGNMNFSPEK  60
VKKRRESNRI SARRSRYKKA TQMQNLQHQL SLLEAENKYL VRHQADLIQK YSNVAIDNRV  120
LKANVEALET KVKLVEEIIK RITSTDDVPQ VVSSLTSLGL YLSASPSNGA YETSVPTQNT  180
PFNNFTAVAT NGGVNNIYTP EATSTFQSQD RVALLQMQSE PSLEHLQRGV CDGVPSSSML  240
APQEVAPFDP NEFINMGMQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G187000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024314191.11e-150LOW QUALITY PROTEIN: bZIP transcription factor RISBZ2
TrEMBLA0A0Q3K7X81e-161A0A0Q3K7X8_BRADI; Uncharacterized protein
STRINGBRADI1G55450.11e-159(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2520255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.17e-16basic leucine zipper 9