PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G133300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 170aa    MW: 18726.3 Da    PI: 10.8394
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G133300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.56.2e-221360249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        +i ++s+rqvtfskRr g++KKA+EL+ LC+a+ a+++fs+ g+ + +
  Brast06G133300.1.p 13 PIGDTSRRQVTFSKRRSGLFKKASELCALCGADLALVVFSPAGRAFAF 60
                        5889**************************************987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.203464IPR002100Transcription factor, MADS-box
SMARTSM004324.5E-27463IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-25577IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-19626IPR002100Transcription factor, MADS-box
PfamPF003191.3E-231460IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-192641IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-194162IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MATRGRQRIE IRPIGDTSRR QVTFSKRRSG LFKKASELCA LCGADLALVV FSPAGRAFAF  60
GNPSVDHVLG RHGGAPPLLV LDERAERDAA AATRTELEEA KARVGAEQAR LGAVEEKVRL  120
AMAGRRFYWE ADVEALGEAE LREFARALIR LRDDVRRREN ALLSQSNNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-16572269Myocyte-specific enhancer factor 2B
1tqe_Q8e-16572269Myocyte-specific enhancer factor 2B
1tqe_R8e-16572269Myocyte-specific enhancer factor 2B
1tqe_S8e-16572269Myocyte-specific enhancer factor 2B
6c9l_A8e-16572269Myocyte-specific enhancer factor 2B
6c9l_B8e-16572269Myocyte-specific enhancer factor 2B
6c9l_C8e-16572269Myocyte-specific enhancer factor 2B
6c9l_D8e-16572269Myocyte-specific enhancer factor 2B
6c9l_E8e-16572269Myocyte-specific enhancer factor 2B
6c9l_F8e-16572269Myocyte-specific enhancer factor 2B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G133300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693391e-114KF469339.1 Brachypodium distachyon MADS-box transcription factor 45 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288318.15e-83agamous-like MADS-box protein AGL61-like
TrEMBLA0A0Q3KYP42e-81A0A0Q3KYP4_BRADI; Uncharacterized protein
TrEMBLI1GUH51e-81I1GUH5_BRADI; MADS-box transcription factor 45
STRINGBRADI1G27900.12e-82(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28333088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-28AGAMOUS-like 61