PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G100300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 304aa    MW: 34086.1 Da    PI: 8.0597
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G100300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.12.3e-181050242
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        ri++   r +tf kRr g++KKA+EL +LC+ +++vi++++
  Brast06G100300.1.p 10 RISDAAARRTTFRKRRDGLMKKASELATLCNLKACVIVYGE 50
                        89*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.867150IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-23160IPR002100Transcription factor, MADS-box
CDDcd002661.81E-26285No hitNo description
SuperFamilySSF554552.62E-22394IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-171056IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MARKKVSLRR ISDAAARRTT FRKRRDGLMK KASELATLCN LKACVIVYGE GDAQPHVWPS  60
VAEALPILHR FKAMPELEQY KKTVNQEVFL RQRVDKLREQ NQKLRRENHE RHTMCLLHKA  120
MLGQLPGLMG LTIEEVTSVG WMAKYYLKSI GDRIVELSRQ AGLQAPPATY IPSNDMMTMG  180
DPSLEECLQM PQQEMWIDNI RIEGEDLNVL PYSDNGAGPS TTDLRGDLIS WAEGFDLDAS  240
SEAHIGGDGT ELNAATHERT KDPTYNVKIA LSTNAGCAGI GMTWLLERPG KWCSGDPLCR  300
YRR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVSLRRISDAAARRTTFRKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G100300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024313046.11e-163agamous-like MADS-box protein AGL80
TrEMBLA0A2K2DL161e-162A0A2K2DL16_BRADI; Uncharacterized protein
STRINGEMT028027e-61(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-26AGAMOUS-like 80