PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G033500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 614aa    MW: 65647.7 Da    PI: 7.4361
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G033500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.6e-14157218263
                         XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         +e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a lk+++
  Brast06G033500.1.p 157 EEAKRRARLVRNRESAHMSRQRKKQYVEELEGKVKAMQATIADLSARISCATAENAVLKQQL 218
                         799**********************************************9999999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-12155220IPR004827Basic-leucine zipper domain
PfamPF001702.2E-12157218IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.967158221IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.0E-16160219No hitNo description
SuperFamilySSF579591.53E-12160218No hitNo description
CDDcd147045.41E-19161212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MTAKTNPLFP LQTLHASATV IRKPQPPPLY ALAMTGSAAH MAEPCLFADM PSFLDDLPEF  60
PHPVDDDNFA LEDFDLDDLD IDFDLDLFPT DDAQLSPPPP PLASSSSSAG SPGGGSSSSG  120
GGVDGGGGGL KNDESSESSS RIADAGSDGK PRDGEDEEAK RRARLVRNRE SAHMSRQRKK  180
QYVEELEGKV KAMQATIADL SARISCATAE NAVLKQQLSG AAGAGAPPPL LPMYPGLYPL  240
PPPWLHPAYA MRGSQVPLVP IPRLKTRKPA PAEVEPPAKK TRKTKKVASV SLLGLLFLVM  300
VCGCLVPAVN RMYGAVDSGE GIVLAPSHHG RVLAVEGPRN AVPDGIDSKL PQNSSETLPA  360
LLYLPRNGKH VKINGNLVIK SIVASEKASS RMSRYDQKIS GNPGNQETSL AIPGHVAKLD  420
SEEVPKAAQG IKNKLMALPP GDRRIYREDD ELLPQWFSEA MSGPMLSSGM CTEVFQFDIS  480
TTSADANGIV PVYSSAMPNS SHNLTENLPS ARPQKIKNRR ILHSVPIPLQ GSTANHTDRL  540
KERLKEHPKN ESFAGNKPAS SVVVSVLADP REDGEGRISS KSLSRIFVVV LVDSVKYVTY  600
SCVLPFKNHS PHL*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response. Acts as ER stress sensor and activates the transcription factor BZIP50 and the chaperone BIP1. {ECO:0000269|PubMed:22050533}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G033500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol- and tunicamycin-induced endoplasmic reticulum (ER) stress response. {ECO:0000305|PubMed:22050533}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562569.10.0bZIP transcription factor 60
SwissprotQ8LIB30.0BZP60_ORYSJ; bZIP transcription factor 60
TrEMBLI1GRS70.0I1GRS7_BRADI; Uncharacterized protein
STRINGBRADI1G19702.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-82bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Oono Y, et al.
    Analysis of ER stress in developing rice endosperm accumulating beta-amyloid peptide.
    Plant Biotechnol. J., 2010. 8(6): p. 691-718
    [PMID:20331531]
  3. Hu J, et al.
    The Bphi008a gene interacts with the ethylene pathway and transcriptionally regulates MAPK genes in the response of rice to brown planthopper feeding.
    Plant Physiol., 2011. 156(2): p. 856-72
    [PMID:21487048]
  4. Takahashi H,Kawakatsu T,Wakasa Y,Hayashi S,Takaiwa F
    A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.
    Plant Cell Physiol., 2012. 53(1): p. 144-53
    [PMID:22084314]
  5. Ohta M, et al.
    Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.
    J. Exp. Bot., 2013. 64(18): p. 5429-41
    [PMID:24153418]
  6. Cheng Q, et al.
    An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice.
    Plant Biol (Stuttg), 2015. 17(2): p. 419-29
    [PMID:25255693]