PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G011500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 270aa    MW: 29342.7 Da    PI: 8.0714
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G011500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.73.4e-1064112553
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                         kr +r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  Brast06G011500.1.p  64 KRVKRIIANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQ 112
                         899**************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-1660124IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.51962125IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-1164118No hitNo description
SuperFamilySSF579593.16E-1164115No hitNo description
PfamPF001703.4E-964108IPR004827Basic-leucine zipper domain
CDDcd147038.08E-2265114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEKVAGTSSS PPRPTKHRHS ASFDGGGGAG KQKGGAGGVF SDVLEAKKAM SSEELSELAS  60
VDPKRVKRII ANRQSAARSK ERKARYITEL ERKVQTLQTE ATTLSAQLTL FQRDTTGLSA  120
ENTELKIRLQ AMEQQAQLRD ALNDALKQEV ERLKIATGET TKSDEAYDRG MHHVPYSSSF  180
FQPSEQHSVQ HHASVHQLPP QVQPPHPSVP GHQMPSHPNT FPDMMQQDSL GRLQGLDLGK  240
GSVPVKSEAD ELLKSEGSSL SANESNNTF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G011500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562448.11e-167transcription factor RF2b
SwissprotQ6S4P41e-113RF2B_ORYSJ; Transcription factor RF2b
TrEMBLI1GR481e-165I1GR48_BRADI; Uncharacterized protein
STRINGBRADI1G17700.11e-166(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-60bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]