PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G008800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 266aa    MW: 28527.9 Da    PI: 7.9055
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G008800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.23.8e-152181257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  Brast06G008800.1.p 21 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLqrfgPVADANVFYWFQNRRSRSRR 81
                        89*****************99****************99999****************997 PP

2Wus_type_Homeobox105.73e-342083265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ L+++G + d+NVfyWFQNr++R+r++q
  Brast06G008800.1.p 20 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLQRFGPVADANVFYWFQNRRSRSRRRQ 83
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.08E-131488IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-81689IPR009057Homeodomain-like
PROSITE profilePS5007111.2721782IPR001356Homeobox domain
SMARTSM003897.0E-61986IPR001356Homeobox domain
PfamPF000467.3E-132181IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEGGGQIHSE ESSRMQGETV RSRWTPKPEQ ILILESIFNS GMVNPPKDET VRIRKLLQRF  60
GPVADANVFY WFQNRRSRSR RRQRQLQQAQ QAQQQAQAQQ SPAALSPAPA MAAAHMGGYS  120
SSSSSSSTWP PSSPPSAGIM MDGGGGDDLF AISRQMGYGS GSSSSSSAPA AAAMAHEHQQ  180
QMYYSYQQQQ QAAGGMMMSS STMTVYINGV ATEVPARGPV DVRAMFGDDA VLVHAAGGLL  240
PVDDYGVLLH SLQMGESYFL VSRSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126151e-78CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankAP0149631e-78AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0051671e-78AP005167.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0060O17.
GenBankAK0732321e-78AK073232.1 Oryza sativa Japonica Group cDNA clone:J033021B15, full insert sequence.
GenBankAK0635031e-78AK063503.1 Oryza sativa Japonica Group cDNA clone:001-116-E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233791.12e-98PREDICTED: WUSCHEL-related homeobox 11-like
SwissprotQ0D3I72e-69WOX11_ORYSJ; WUSCHEL-related homeobox 11
TrEMBLI1GR173e-98I1GR17_BRADI; Uncharacterized protein
STRINGBRADI1G17420.18e-98(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.22e-31WUSCHEL related homeobox 12