PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G007800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 283aa    MW: 30272.2 Da    PI: 9.3442
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G007800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1551.8e-17171221556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk el++l+ ++
  Brast06G007800.1.p 171 RRQKRMIKNRESAARSRARKQAYMNELENKVSRLEEENRRLK-ELKRLEPMA 221
                         79****************************************.9**999775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-13167230IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.369169213IPR004827Basic-leucine zipper domain
CDDcd147071.09E-19171224No hitNo description
SuperFamilySSF579594.81E-11171213No hitNo description
PfamPF001701.6E-13171217IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-14171217No hitNo description
PROSITE patternPS000360174189IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGVQTMAAAS LGGGGGRQGA AVYGLTLNEV ESRLGSPLRS MNLDELLRTV LPAAAAGGGP  60
PGPGKKTVDE VWRDIESAAR GRQPAAMEVG EMTLEDFLSR AGVPVDGGGA HWLLHQYHPP  120
PRPLPAYHGH GGGGGGGFLS PSQAGGGRKR GAGGEDEGGG GGGGGEKTVE RRQKRMIKNR  180
ESAARSRARK QAYMNELENK VSRLEEENRR LKELKRLEPM AGQCVSRPEP MLQRLEPMVV  240
QYVTRPEPMV VQYVPEPEPE PEPEPEPKQH QLQLRRTISA SF*
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast06G007800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757254.11e-118ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9C5Q21e-43AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLA0A0Q3GUA01e-117A0A0Q3GUA0_BRADI; Uncharacterized protein
STRINGBRADI1G17335.11e-115(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44413367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.31e-26bZIP family protein
Publications ? help Back to Top
  1. Haas BJ, et al.
    Full-length messenger RNA sequences greatly improve genome annotation.
    Genome Biol., 2002. 3(6): p. RESEARCH0029
    [PMID:12093376]
  2. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  3. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]