PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G296500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 191aa    MW: 20513.2 Da    PI: 6.9893
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G296500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.45.2e-43131131101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+Ca+dCv+apyfp e+p++fa vh++FGasnv+k+l++lp  +r da+sslvyeA arardPvyG++g i+ lq+q++ql+
  Brast05G296500.1.p  13 PCASCKLLRRRCARDCVFAPYFPPEDPARFATVHRVFGASNVSKMLQELPAAQRADAVSSLVYEATARARDPVYGCAGAISYLQHQVAQLQ 103
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         ++la++++++
  Brast05G296500.1.p 104 VQLAVAQAQI 113
                         *****99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.38912113IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4313110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAGAQGGGSS STPCASCKLL RRRCARDCVF APYFPPEDPA RFATVHRVFG ASNVSKMLQE  60
LPAAQRADAV SSLVYEATAR ARDPVYGCAG AISYLQHQVA QLQVQLAVAQ AQILHRVHPP  120
PSSSSPSPAP PLPLHDLQQL QQQQSLQMDY DYDDDVKAGY GSGLVTQNDL MNSLLLQEAC  180
CGLKKESLWT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4591147112LOB family transfactor Ramosa2.1
5ly0_B7e-4591147112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G296500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238823.11e-105LOB domain-containing protein 4
SwissprotQ8LBW32e-60LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2K2CU801e-104A0A2K2CU80_BRADI; Uncharacterized protein
STRINGBRADI4G44850.11e-104(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-51LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]