PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G264700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 299aa    MW: 31403 Da    PI: 5.5423
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G264700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-10113175163
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +l+  +
  Brast05G264700.1.p 113 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNESMKKEKETVMQEYLTLQETN 175
                         89******************************************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.5E-5110176No hitNo description
PfamPF001701.1E-8113175IPR004827Basic-leucine zipper domain
SMARTSM003381.1E-11113177IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.967115178IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.09E-6117171No hitNo description
CDDcd147024.63E-13118168No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MPRSPPTSAN RQRQCRRGGG GDEDVELDAA MALADMAGAA RPPPPPQAEE EEASTRLSLD  60
LGEAGIVQGA AAASSACSSA GQQQQQQVLP AVAAPGPGGY GARPRHSTLT EAEKEAKRLR  120
RVLANRESAR QTILRRQAIR DELARKVADL SSQNESMKKE KETVMQEYLT LQETNKQLKE  180
QAAAKASSLA PVATDMDTAE EPARGAQATS SSPAPPPHPG FLCAAAGPPA MPLPVRPYVW  240
GSWPPGYDPR AGTGKEDDDP CSLTLGLDVS GADKAAEARR NEMTKTKQPQ AGARPGED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G264700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2457506e-66DQ245750.1 Zea mays clone 20079 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757911.21e-86uncharacterized protein LOC100826071
TrEMBLA0A2K2CTS24e-95A0A2K2CTS2_BRADI; Uncharacterized protein
STRINGTraes_5BL_6C613A3D9.15e-73(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.14e-13bZIP family protein