PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G243000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family ZF-HD
Protein Properties Length: 306aa    MW: 32618.7 Da    PI: 8.1978
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G243000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.32.8e-3188141357
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                         ++rY+eClkNhAas+Gg a+DGCgEfmp+ ge+g++ al C+ACgCHRnFHR+++
  Brast05G243000.1.p  88 SARYRECLKNHAASIGGSATDGCGEFMPA-GEDGSMGALLCSACGCHRNFHRKDT 141
                         689*************************9.999********************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047708.7E-2889141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-2890140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257749.0E-2090140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.99791140IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.605.0E-29193264IPR009057Homeodomain-like
SuperFamilySSF466898.16E-19196262IPR009057Homeodomain-like
TIGRFAMsTIGR015651.5E-27204260IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MDLSGAQGEL SMPMPIAMHG AAAASPYSLA LHPHHQQQQL QLAGANGRHL SPPAPVTTTS  60
SPAAMAGGAE EEEEDEYSKS RQLAVASSAR YRECLKNHAA SIGGSATDGC GEFMPAGEDG  120
SMGALLCSAC GCHRNFHRKD TLIMGLNAAA AHQYPMAAHQ QQRRGLLVGP TRMVMPLSAA  180
AAMGAHHQMA MAETTSDEGG APRRKRFRTK FTAEQKARML GFAEEAGWRL QKLDDDAVHR  240
FCAEVGVKRR VLKVWMHNNK HTLASRRHHQ PPLPAAGDGE DDHRAANAAA GSSPSATQTQ  300
QLRLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-232052621875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G243000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL9548536e-69AL954853.5 Oryza sativa chromosome 12, . BAC OSJNBb0071I17 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149686e-69AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankCT8355266e-69CT835526.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA034F08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238617.11e-125zinc-finger homeodomain protein 3
SwissprotQ2QW442e-71ZHD3_ORYSJ; Zinc-finger homeodomain protein 3
TrEMBLA0A0Q3EZI81e-124A0A0Q3EZI8_BRADI; Uncharacterized protein
STRINGBRADI4G40270.11e-106(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-54homeobox protein 31