PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G232200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 212aa    MW: 22269.2 Da    PI: 8.0514
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G232200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF702.1e-221865249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        ri+++  rqv fskRr+g++KKA+ELS+LC+++va i+fs+ gk + +
  Brast05G232200.1.p 18 RIDSEEARQVCFSKRRAGLFKKASELSILCGVQVAAIVFSPAGKAFSF 65
                        89*****************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.22E-27979IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-32968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.212969IPR002100Transcription factor, MADS-box
CDDcd002652.56E-371078No hitNo description
PRINTSPR004045.0E-201131IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251865IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-203146IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-204667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MARRRPTSLG RQKIEIRRID SEEARQVCFS KRRAGLFKKA SELSILCGVQ VAAIVFSPAG  60
KAFSFGTPSV DNVLNRFLGG GAAARPGTGS NARSTAEAPV LAELNRRYGE LRAQLEAERA  120
CAEVLRKEAA AAAGAPAWLD KEVSEMEEEE LIASAEALVE VSAARMMMPQ PQQQLGGFGF  180
AAASSSSSNA DAVNGGLTEM QGAGFIGPPH F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-17991183MEF2C
5f28_B1e-17991183MEF2C
5f28_C1e-17991183MEF2C
5f28_D1e-17991183MEF2C
6byy_A2e-179107191MEF2 CHIMERA
6byy_B2e-179107191MEF2 CHIMERA
6byy_C2e-179107191MEF2 CHIMERA
6byy_D2e-179107191MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G232200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693463e-73KF469346.1 Brachypodium distachyon MADS-box transcription factor 52 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238576.12e-72agamous-like MADS-box protein AGL61
TrEMBLA0A0Q3J0492e-65A0A0Q3J049_BRADI; Uncharacterized protein
STRINGBRADI4G39420.15e-57(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-29AGAMOUS-like 62