PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G232100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 263aa    MW: 27525.5 Da    PI: 6.7852
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G232100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.71.3e-221764249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        ri+++  rqv fskRr+g++KKA+ELSvLC+++va i+fs+ gk + +
  Brast05G232100.1.p 17 RIDSDEARQVCFSKRRAGLFKKASELSVLCGTQVAAIVFSPAGKAFSF 64
                        89*****************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.422868IPR002100Transcription factor, MADS-box
SMARTSM004324.7E-33867IPR002100Transcription factor, MADS-box
CDDcd002657.92E-37977No hitNo description
SuperFamilySSF554556.15E-27977IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-201030IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241764IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-203045IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-204566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MARRRPSLGR QKIEIRRIDS DEARQVCFSK RRAGLFKKAS ELSVLCGTQV AAIVFSPAGK  60
AFSFGTPSVD AVLDRFLLGA AARPATGGRV AAEAPALAEL NRQYAELRAQ VEAEKARAEA  120
LRKEQKEAAA APGAPAWLDK EVSEMEESEL VDFAEALVEI QAAVQARADQ VLREALLASA  180
ARAPPPPPPA AAITAAAARM MISPQPQLGG FGFAAASSSG AGAVDGGLME MQAQQQQQQA  240
MEMMIQGFGP QQGAGFLGPP PF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A6e-17876169MEF2C
5f28_B6e-17876169MEF2C
5f28_C6e-17876169MEF2C
5f28_D6e-17876169MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G232100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238576.12e-94agamous-like MADS-box protein AGL61
TrEMBLI1ITC54e-92I1ITC5_BRADI; MADS-box transcription factor 52
STRINGBRADI4G39420.17e-93(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.16e-30AGAMOUS-like 61