PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G197700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 202aa    MW: 20819.6 Da    PI: 10.1639
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G197700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1521.5e-16132183556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         +r +r++kNRe+A+rsR+RK+a + +Le +v eL+ eN++L+ + e+lk  +
  Brast05G197700.1.p 132 RRKKRMIKNRESASRSRARKQAHVTQLESEVRELQRENDDLRVKYEQLKASA 183
                         699*********************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-11128195IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.645130180IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-14132183No hitNo description
CDDcd147073.95E-20132186No hitNo description
PfamPF001708.8E-14132182IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.13E-12132181No hitNo description
PROSITE patternPS000360135150IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAMAALEDDD DMWAVTTSPS ASPPATAAAA AISTALSLNS RLHLLASSSP FHPGFGVGGC  60
SRNAAAAPPP CFFSAAASSS FPHFAAPLDG AGRALERGMC GLAQPPAWSG AAPAGVGVVG  120
AGASGCGGPV ERRKKRMIKN RESASRSRAR KQAHVTQLES EVRELQREND DLRVKYEQLK  180
ASAEAPVPVK RTLKRVLSAP F*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G197700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578537.23e-85bZIP transcription factor TRAB1 isoform X1
TrEMBLA0A0Q3LF286e-84A0A0Q3LF28_BRADI; Uncharacterized protein
STRINGBRADI4G36587.13e-83(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17770.29e-19basic region/leucine zipper motif 27