PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G185600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TCP
Protein Properties Length: 305aa    MW: 31426.9 Da    PI: 6.0251
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G185600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP106.35e-3331107683
                 TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                         +r+ ++hTkv+gR+RR+R+ a+caar+  L++eLG+++d++ti WLlqq++pai ++tgt++ +a ++ +++ +    
  Brast05G185600.1.p  31 QRNRDRHTKVEGRGRRIRMAAPCAARVARLTRELGHKSDGETIRWLLQQSEPAIVAATGTGTVPAIAT-TVDGVLRIP 107
                         799*********************************************************88888444.222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136924.8643387IPR017887Transcription factor TCP subgroup
PfamPF036341.7E-2633118IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MAPTDPTAAN GSIVPKPEPE FLGGLAVALP QRNRDRHTKV EGRGRRIRMA APCAARVARL  60
TRELGHKSDG ETIRWLLQQS EPAIVAATGT GTVPAIATTV DGVLRIPTES PSSAPGGDGE  120
ESGPKRRRKL QPTRAPAGPA QQLLTAPPAA YYSAATDPLL QGSGGGAISM SSGLSTVSTP  180
TGGAIPFIAI PAPGSSAAGD GKQMVPPAAV WMVPQPSGVV GSANQPTHYW AFQTNSELVN  240
FAGAQSFNVA NYQHHQACYS PMQFAVGGEP RDQQTGGQVS TGDQPQGLQD DYDGEALTDS  300
SSEE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123129PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G185600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576745.10.0transcription factor PCF2
SwissprotA2YXQ17e-93PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH67e-93PCF2_ORYSJ; Transcription factor PCF2
TrEMBLI1IRY80.0I1IRY8_BRADI; Uncharacterized protein
STRINGBRADI4G35520.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.17e-39TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]