PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G183700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 462aa    MW: 49089.1 Da    PI: 10.6353
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G183700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.58.1e-10311357551
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                         kr +r   NR++A +s +RK  ++ eLe+kv++L++e  +L  ++ +
  Brast05G183700.1.p 311 KRVKRILNNRVSAAKSKERKVRYMSELERKVQVLQKETATLTGQVAM 357
                         899***********************************999876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-12307371IPR004827Basic-leucine zipper domain
PfamPF077166.5E-9308360IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.473309372IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-11311365No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-11311363No hitNo description
CDDcd147033.11E-20312362No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MDDDPVRRRR LLALPGPRLP ADSYGSRVPP SFLLPPVHPA PARFGQGAFG YYQAPPPPAS  60
GGGGGGAGSS HHARSLSQPQ FSSMDFLFGQ NSYANPAAPT PIAFARPQPP PANSPSGLPP  120
LRAGHRRSQS DIQLGFSQPN LQMPPPAPVN PPTPAPEGRE PVTANKNKTL ADGPLGSHKS  180
PKGLGVAGSS ADAAQVDSQV RGPRAWSPAD SSDNETESAD GRVPRHGRSL SADSFVGKLT  240
FGSVGLVSSN LPPSSPGTEA PGRLARSGSG SIGGAAALVA KDIAIGGFSE ADKKKIMENE  300
RLAEIVLTDP KRVKRILNNR VSAAKSKERK VRYMSELERK VQVLQKETAT LTGQVAMIQR  360
DHSVLSTHNN ELKIRLQAME QQAQLRDALS ETLNSEVQRL KLAAGEISDP HVLNGSQQQM  420
SSQMIQLQQL QILKQSSQTQ QVQQQPQHSV QPGAQQQQWN V*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G183700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576738.10.0transcription factor RF2a
TrEMBLI1IRX00.0I1IRX0_BRADI; Uncharacterized protein
STRINGBRADI4G35370.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148701820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-50bZIP family protein