PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G165300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 398aa    MW: 41468.4 Da    PI: 8.225
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G165300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.72.9e-4273148176
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         +CqvegC +dls  k+y+ rhkvC++hskap v+v+g++qrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Brast05G165300.2.p  73 RCQVEGCGVDLSGDKTYYCRHKVCSMHSKAPLVVVAGIQQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKP 148
                         6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-3466135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.96671148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-4072152IPR004333Transcription factor, SBP-box
PfamPF031102.7E-3374147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
METGSSGGGG GDDFHGLKFG QKIYFEQDVA SGSGTTASSS AGSAAPSGGA GAGGAAAAAA  60
SAAHGNNTAQ PPRCQVEGCG VDLSGDKTYY CRHKVCSMHS KAPLVVVAGI QQRFCQQCSR  120
FHQLPEFDQG KRSCRRRLAG HNERRRKPPP GPLSSRYGRL AASFHDPGRF RSFLLDFSYP  180
RVPSSVRDAW PTAHPGEHHR MPGTAAQWQG SHDLHHPHRS TVAGYGDHHA YAGQGSSSGG  240
AAPMYPSFEL PAAECIAGVT AADSSCALSL LSTQPWDHSA HSASHNRSPA MSTASAFQGS  300
PVAPSVMTSD YVAAAAASNS AWASTRGRNM QHHHHHDAVM NEVHPGSVHQ QGGQFGELEL  360
ALQQGRAGAP NTPHAEHGPA GAGTFGHHSS NAMNWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-29741471184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G165300.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757598.10.0squamosa promoter-binding-like protein 17 isoform X2
SwissprotA3C0571e-144SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A0Q3PMV70.0A0A0Q3PMV7_BRADI; Uncharacterized protein
STRINGBRADI4G33770.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.18e-45squamosa promoter binding protein-like 9