PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G155300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 187aa    MW: 20922.3 Da    PI: 7.7437
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G155300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.97.7e-1281132152
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                         e+e +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L +el++ 
  Brast05G155300.1.p  81 EEEERRRRRMVSNRESARRSRVRKQRQLSELWAQVVHLRGANRRLLDELNQA 132
                         67889*****************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.5E-980131No hitNo description
PfamPF001701.6E-981133IPR004827Basic-leucine zipper domain
SMARTSM003381.2E-1181145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.05983134IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-1085133No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
CDDcd147025.80E-1390134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MLHHYHGEVA SLHCLTPPNP PLFHTHFQSS MIAMAPPPFQ FSAAAYEDEP AVQVQEPLAA  60
ISNSSGGAGD TDIHGRAAAA EEEERRRRRM VSNRESARRS RVRKQRQLSE LWAQVVHLRG  120
ANRRLLDELN QAMRGRDDVL RENGRLSDEK AELETRLQQC LMRAQENNNI NAPSSSSYKN  180
TTTAAE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197103RRSRVRK
297104RRSRVRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G155300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576641.11e-89bZIP transcription factor 11
TrEMBLI1IQZ93e-88I1IQZ9_BRADI; Uncharacterized protein
STRINGBRADI4G32920.14e-89(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-12basic leucine-zipper 42