PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G146200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 354aa    MW: 38611.6 Da    PI: 8.2198
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G146200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.6e-14274325556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L  +  e+ ++ 
  Brast05G146200.1.p 274 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNQKLERKQAEIMEMQ 325
                         79*************************************9998888777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-10270328IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.829272323IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-13274323No hitNo description
CDDcd147071.27E-24274326No hitNo description
SuperFamilySSF579591.31E-9274322No hitNo description
PfamPF001705.1E-12274325IPR004827Basic-leucine zipper domain
PROSITE patternPS000360277292IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MLTEDRWART EGIMEFRTGG SSPEHRPSVD ESTPLARQGS VYSLTLEEFH STLGGGGLGK  60
DFSSMNMDEL LRSIWTTEER QAMASASASA AGAGAPPTSL QRQGSLTLPR TLSAKTVDEV  120
WRNLVRDDPL PIGADGGEQQ PHRQAMLGEM TLEEFLVKAG VVREIPTAPP HPVPVAPKNT  180
AFYRNFPSVN DASAAIVGFP PVGMGDLALC NGLIPRAVGV GGNAGAVQTA ANQLDSDSKG  240
SEDLSSPSEP MPYSFEGIVR GRRPGGGVEK VVERRQRRMI KNRESAARSR ARKQAYTMEL  300
EAEVQKLKEL NQKLERKQAE IMEMQKNEDV PEMKDQFGRK KRQCLRRTLT GPW*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G146200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578228.10.0bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-106TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLI1IQQ50.0I1IQQ5_BRADI; Uncharacterized protein
STRINGBRADI4G32090.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.36e-37abscisic acid responsive elements-binding factor 3
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]