PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G108300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 373aa    MW: 40949.7 Da    PI: 4.6494
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G108300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.51.1e-38621621101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC++dC+la+yfpa+q+++f n+h+lFG+sn++++l+++p+e r+dam++l+++Ae+ra dPv G++ +  +lq+ql+ ++
  Brast05G108300.1.p  62 ACAACKYQRRKCNPDCPLARYFPADQQRRFLNAHRLFGVSNIQRTLRETPPELRTDAMRALIFQAEVRAYDPVGGCCHMAIDLQRQLNLAQ 152
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         aela+l+++l
  Brast05G108300.1.p 153 AELAALHQQL 162
                         ******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.38661162IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-3662159IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MTSDSNSKQP PPPTRHLHIT TPNPTSSATH SSRSPRVAAS GASSPSSGSG HHQNPNQQQN  60
QACAACKYQR RKCNPDCPLA RYFPADQQRR FLNAHRLFGV SNIQRTLRET PPELRTDAMR  120
ALIFQAEVRA YDPVGGCCHM AIDLQRQLNL AQAELAALHQ QLELCRRQQH HAVDDDDDQM  180
LLVADGQDVV VDDAVVDALY VNGGGAGQEN VVLGQANLGE QYLLEEHGQP EQEPHQLYDY  240
FYYDGTAGDE TSGHAWTNDV QTQQQYGNNE GSGVALVEQF EQHCQIDQTQ FVDVFDVKPE  300
TTPTSTTAII ESHIKADNGN ASQFEDLYED EGKAMVSTAV VKSELDHLQM AESSGTGSRC  360
QLELGFSSSN AW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-256316212111LOB family transfactor Ramosa2.1
5ly0_B1e-256316212111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G108300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239347.10.0uncharacterized protein LOC104585088
TrEMBLA0A0Q3IVG70.0A0A0Q3IVG7_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-23LOB domain-containing protein 22