PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G081700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 328aa    MW: 35188.4 Da    PI: 8.64
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G081700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-4070146278
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         C v+gC++dls+++eyhrrhkvCe+hsk+pvv+v+g+e+rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Brast05G081700.2.p  70 CSVDGCRSDLSRCREYHRRHKVCEAHSKTPVVVVAGQEKRFCQQCSRFHMLAEFDEGKRSCRKRLHGHNRRRRKPQH 146
                         **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.6E-3365131IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.88167144IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-3869149IPR004333Transcription factor, SBP-box
PfamPF031108.0E-3070143IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDWAAAPEAV SWGVAAEAVA DPGPTMLSFA SPSFSSSAAV VEQLQDRSRP ASVTARRSRA  60
PGSAAGTVGC SVDGCRSDLS RCREYHRRHK VCEAHSKTPV VVVAGQEKRF CQQCSRFHML  120
AEFDEGKRSC RKRLHGHNRR RRKPQHDAMN PRSFFPYHQV NKFSVYPRTF PIADPNAGAS  180
MHPLEHHRPF SISFSGTIKA PKHFPFLQDG SSIYSTDSPT LPQPFSSREG CNNNRSSTCN  240
GLSSALDPEC ALSLLSSSLH LSPISIPSAT VPAQFASSLA RTAVDSQTAT IAFASGGDGG  300
GGGGGHVLVP DAMFEDPSQG MPFCWQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-2764143584squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126143KRSCRKRLHGHNRRRRKP
2130141RKRLHGHNRRRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G081700.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577554.20.0putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-116SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A0Q3ELQ90.0A0A0Q3ELQ9_BRADI; Uncharacterized protein
STRINGBRADI4G18900.11e-122(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-31SBP family protein