PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G050700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 357aa    MW: 39620.1 Da    PI: 9.3626
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G050700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.13.3e-072272731763
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         A+rsR RK+++i+eLe kv++L++e  +   e+e l+++   l+ e+
  Brast05G050700.1.p 227 AQRSRVRKLQYIAELEGKVQSLQSEGIEVSAEMEFLTQQNMMLDLEN 273
                         89***********************9999999999999988777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-6216275IPR004827Basic-leucine zipper domain
CDDcd147031.93E-15217267No hitNo description
SuperFamilySSF579591.86E-6226269No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-7227269No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MMMANAKLQK QALLPPRSPF PTAASPYGDH GPIARPLGQG QGATHHRFGH GHGHGHHQRT  60
SSESIIEEQP SWLDDLLEEP ETPVRRAGHR RSSSDSFALF DGSAASGAYA NGFEEMGGGG  120
QAAPWGGVQE YYAKPSLYGR PQGRPWEQGM PNLAGYRPGP PMPVREKVGA HHGPPSVFRD  180
HDHVLDRRAP DEGGYDQKVG AERKDVLPKH TQPQSDADTK RAKQQYAQRS RVRKLQYIAE  240
LEGKVQSLQS EGIEVSAEME FLTQQNMMLD LENKALKQRL ESIAKEQVIK RVQQEMFERE  300
IGRLRSLYQQ QQQQPPQPST LARSNSRDLD SQFANLSLKH KDPNAGRDAV SGPLRT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G050700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577697.10.0uncharacterized protein At4g06598
TrEMBLI1IMI90.0I1IMI9_BRADI; Uncharacterized protein
STRINGBRADI4G22130.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.23e-70bZIP family protein