PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G015000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 424aa    MW: 44831.5 Da    PI: 8.4914
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G015000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.45.4e-12271332162
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         +ke +r rr ++NRe+Ar+  +R+ka i+eLe+kv+eL++e + Lkke +e+ +++ +l  +
  Brast05G015000.1.p 271 QKEAQRLRRIISNRESARKTSLRRKALIAELEKKVAELTTEKENLKKEKDEWMEKYLALLEK 332
                         6899***************************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.6E-8269328No hitNo description
SMARTSM003384.6E-8271335IPR004827Basic-leucine zipper domain
PfamPF001708.8E-9271332IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.611273318IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-7276327No hitNo description
CDDcd147021.38E-11276326No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MVSASALGLT FLALVLPAAR AAAPLALPQL NPGRFRRPRA ILGGPCALLF PLDFEVEVPS  60
FPACGHRRPR RLLLTRRCPR DKPLPAPKGT DRLAENKRGD DCKGLHLDEL GRVGVGVGDG  120
VGFSVGVGVG VGDGVGFSVW VGVGVGDGVG FSVGVGDGIG FNVGVGDGVG FSVGLGVVHI  180
GSRSQIPKMA SDGQSPCRDV IAVLDSDAAA ADMAPLDAKA TSAQASHSAV PAAADQVVMA  240
IANRSPSLKW KTGVAWLQIK LTVNGSLQAE QKEAQRLRRI ISNRESARKT SLRRKALIAE  300
LEKKVAELTT EKENLKKEKD EWMEKYLALL EKQQQEAKMT QKSRPLPSLN CAMPPVPFTW  360
APLQVVAAAE EEGHHRLLPL FSTSQETTMQ AAPLRTQEPP TSSGLEDDDP CSLSLAINAP  420
SDY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G015000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475