PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G009100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family ZF-HD
Protein Properties Length: 98aa    MW: 10336.8 Da    PI: 7.9022
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G009100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer83.91.8e-261872359
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                         v Y +C++NhA  +G h+vDGCgEfmps g++   aa++C ACgCHRnFH re  +
  Brast05G009100.1.p 18 VVGYTKCMRNHALGVGKHSVDGCGEFMPS-GTD-PLAAMTCDACGCHRNFHLREILY 72
                        578*************************9.444.69***************999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.6E-241969IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-141981IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.4E-232170IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.3752169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MGSHGPAPAQ LNGVVTPVVG YTKCMRNHAL GVGKHSVDGC GEFMPSGTDP LAAMTCDACG  60
CHRNFHLREI LYEFSALAPP PTVINRRSPV NNSKMEN*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Probably involved in the regulation of floral induction. {ECO:0000269|PubMed:22319055}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast05G009100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by exposure to long days. {ECO:0000269|PubMed:22319055}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018841116.19e-19PREDICTED: zinc-finger homeodomain protein 2-like
RefseqXP_020180776.13e-20mini zinc finger protein 3-like
SwissprotQ9M9S08e-19ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLI1INP42e-45I1INP4_BRADI; Uncharacterized protein
STRINGBRADI4G26170.13e-46(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.23e-21homeobox protein 31