PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G306400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 485aa    MW: 52193.1 Da    PI: 8.5732
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G306400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.71.3e-41188264278
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         CqvegC++dls+ak+yhr+hkvCevhsk+p+v+v+gle+rfCqqCsrfh+l efD+ krsCrrrL++hn+rrrk+q+
  Brast04G306400.1.p 188 CQVEGCKVDLSSAKDYHRKHKVCEVHSKTPKVVVAGLERRFCQQCSRFHALAEFDQIKRSCRRRLNDHNHRRRKPQP 264
                         **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-33180249IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.359185262IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-39187267IPR004333Transcription factor, SBP-box
PfamPF031105.9E-31188261IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MGSFGMDWNQ KSSVLWDWEN LLPAGANAAE NPKIGMQAEQ RFASVVAAMG NESLHSSGSS  60
GTFSSNSEMG YGSSKSSLSA SIDSSSKVGN SMEFRFAPAV NPDSNNSKNT ELGKVDDTGT  120
GTSPSSVIAM SSGEPVIGLK LGKRTYFEDV CGAQNVKNSP LGASAPNPSP ASVKKGKVDQ  180
QKPHNSYCQV EGCKVDLSSA KDYHRKHKVC EVHSKTPKVV VAGLERRFCQ QCSRFHALAE  240
FDQIKRSCRR RLNDHNHRRR KPQPEAISFS TSRLSTMFYD ARQQTSLLFS EAPYVQMRNC  300
AGSSWDDPGP GGFKFTETKA PWLKPTGAGV DTLHLSSQQV SNSIMPHGAH HGFDGFMSFK  360
GTGMKFLNQG VEASSVASNT SGAPDLQRAL SLLSNNPAGA ANLQPSPQMH SGTTADIAGT  420
SNPAMHALGS SPGLWLDSPL LDNHHPRFQA FDRLGGHNST MPHELQLPKH SYDDHAASHF  480
DRMH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-281882611184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast04G306400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024316148.10.0squamosa promoter-binding-like protein 3
RefseqXP_024316149.10.0squamosa promoter-binding-like protein 3
RefseqXP_024316150.10.0squamosa promoter-binding-like protein 3
RefseqXP_024316151.10.0squamosa promoter-binding-like protein 3
RefseqXP_024316152.10.0squamosa promoter-binding-like protein 3
SwissprotA2X0Q60.0SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z80.0SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLI1HX290.0I1HX29_BRADI; Uncharacterized protein
STRINGBRADI3G03510.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-47squamosa promoter binding protein-like 2