PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G290700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 350aa    MW: 36493.9 Da    PI: 5.1652
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G290700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.91.7e-202163850
                        HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          qv fskRr+g+ KKA+EL+vLCda+va+++fs+ gk y ++
  Brast04G290700.1.p 21 ALQVCFSKRRKGLVKKAFELCVLCDAQVALVVFSPAGKPYSFA 63
                        569***********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.292666IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-29665IPR002100Transcription factor, MADS-box
CDDcd002652.16E-32775No hitNo description
SuperFamilySSF554554.84E-26777IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-18828IPR002100Transcription factor, MADS-box
PfamPF003192.0E-231662IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MVKRTQGRQK IQMELIRDPN ALQVCFSKRR KGLVKKAFEL CVLCDAQVAL VVFSPAGKPY  60
SFAHPSFPAV ADRFLGPLSA PAASGTDHAR LGELQREAER LAEAVREAKE TRGKELEAQV  120
RAGAGAWVDG DLSRCGTPQL EAALAALLGV QAEAAERAHE ILAQEATMMQ QQQCAAAGGA  180
GGSHGDIFDY LGSYTAADHG AGGYGGDLFD YLGPGGPQYA PDAMASAHDQ APAMDAAIDL  240
VCSNGAGSLF HYLGSSSSVG SFMADGGGGG NHNEVGAVDT DIRLMGGGMN HTLVPMMPLP  300
PPSALPFSHG GFDYYNLGFS NQGDLGHEHG NRGAFYELDG VYGTTCNFL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast04G290700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693451e-149KF469345.1 Brachypodium distachyon MADS-box transcription factor 51 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289954.11e-154MADS-box protein SVP-like
TrEMBLI1HXK11e-153I1HXK1_BRADI; MADS-box transcription factor 51
STRINGBRADI3G04880.11e-154(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-24AGAMOUS-like 62