PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G280400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 498aa    MW: 53412.2 Da    PI: 7.1131
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G280400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.55e-40233308176
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         +Cq+egC+adls ak+yhrrhkvCe h+ka++v+++g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk+
  Brast04G280400.1.p 233 RCQAEGCKADLSAAKHYHRRHKVCEYHAKAAAVAANGKQQRFCQQCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKP 308
                         6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-34226295IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.188231308IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-37232308IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30234307IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MMSSRQQLSP GTAGTMPPIP GDADFGSGCY TTHHPYAAFD ATVQHHQQQL YDSTTGLDYA  60
AAFSAFVPQQ ADNPAPASAH LFPSLPPSFT TNNNNATMLL QPAMLTPHPG LLPASSPMPS  120
DNNAYLQLQQ QQQQHPFGGF QLKRENEGGL IFPFSSDAMA AAGSIGGSGS GGGRIGLNLG  180
RRTYFSPADV LAVDRLLMRT RGGLGGGQGA MGVLGLGLGG GGIIGHQMQQ PPRCQAEGCK  240
ADLSAAKHYH RRHKVCEYHA KAAAVAANGK QQRFCQQCSR FHVLAEFDEA KRSCRKRLTE  300
HNRRRRKPVG VQGKDSPPPP PSKKLEACIT TSSYAGDHTN TNKSTAAVLS PSASAFSCLQ  360
QQEDQELDDN DEGGGGGRPT TLSLAAPPPQ RDYGGALDTM LLMHHHRHHH HQAAAAVVQE  420
DDHEQAFMMT SLVQSHQQHG DDGNGNILSC SPTSTSDQRR QQHHQMQIND GGDDSGCCNN  480
SGMQQQQQQH FFEVDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-282343071184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290307KRSCRKRLTEHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast04G280400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478825e-80KF447882.1 Triticum aestivum squamosa promoter-binding-like protein 21 (SPL21) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571005.20.0squamosa promoter-binding-like protein 10
SwissprotQ0E3F82e-58SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A2K2CVE40.0A0A2K2CVE4_BRADI; Uncharacterized protein
STRINGBRADI3G05720.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-35squamosa promoter binding protein-like 8