PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G274800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 241aa    MW: 25633.7 Da    PI: 10.3697
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G274800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.13.8e-081431852163
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         RqRKk+++ e ++ v +L+aeN +L +e+  l+  +++l +e+
  Brast04G274800.1.p 143 RQRKKMRLPEVQQLVRSLTAENGSLHEEMRALQRACSALAKEN 185
                         9**************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.0E-5143181No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MATDDDAVAA DIICSLRGAD LGGWTPPWSK RVEAAGELSW PAVARGKRSR RRSPAPAASE  60
GKKGRRCAAR SSPPSPLDYS AGSASLRSGA STSGGEDGGG GGGFCSPWRR RAAGPPPATT  120
KVESIRRPQL TFPAPPPRPT GQRQRKKMRL PEVQQLVRSL TAENGSLHEE MRALQRACSA  180
LAKENDKLEA RVEQRSNSQN AIALKEQKGK QQIDQQPPDD SFALPDLNLP AQDNADAVHC  240
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142148RQRKKMR
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast04G274800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3642103e-64AK364210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233917.11e-142uncharacterized protein LOC100835852
TrEMBLI1HY061e-140I1HY06_BRADI; Uncharacterized protein
STRINGBRADI3G06160.11e-141(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951