PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G236200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 243aa    MW: 26033.2 Da    PI: 5.7008
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G236200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.8e-10115159549
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                         kr +r   NR +A+rsR RK+++i eLe+ v  L+ e +aL  ++
  Brast04G236200.1.p 115 KRVKRILANRQSAQRSRVRKLQYISELERSVTGLQMEVSALSPRV 159
                         8999******************************99999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-11111175IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.461113169IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-11115169No hitNo description
PfamPF001702.9E-9115163IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-12115169No hitNo description
CDDcd147034.48E-20116166No hitNo description
PROSITE patternPS000360118133IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MAQLPPRAPS AAGQQDWSAA GEFLGFAASR RGAHRRSASD SAAFLEAVPM DDDVIGGAEF  60
DRLDDEQLMS MFSDVDAPAV SSDGGGGFMD MGEGEEGSAG ARAMAAAEGG YGDPKRVKRI  120
LANRQSAQRS RVRKLQYISE LERSVTGLQM EVSALSPRVA FLDHQRSLLT VGNSHLRQRI  180
AALAQDKIFK DAHQEALKEE IERLRQVYHQ QQIKATGGAD IATAASMQAK QELLACEGAA  240
MR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast04G236200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By white light. {ECO:0000269|PubMed:18065552}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0962471e-139FP096247.1 Phyllostachys edulis cDNA clone: bphyst038a13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572005.11e-148basic leucine zipper 19
SwissprotQ6K3R91e-108BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLI1HZ751e-146I1HZ75_BRADI; Uncharacterized protein
STRINGBRADI3G09340.11e-147(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-56bZIP family protein