PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G121500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Trihelix
Protein Properties Length: 572aa    MW: 62490.6 Da    PI: 4.0472
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G121500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix89.92.7e-2837121186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+k+ev aLi +r e++e  ++   k++lW+++s+ mr  g++rs+k+Ckekwen+nk++kk+ke++k+r +++ + cpyf+qle
  Brast04G121500.1.p  37 RWPKEEVDALIWLRMEKDELCQDLGGKGQLWDDISAGMRNMGYHRSSKRCKEKWENINKYFKKVKESKKRR-PQDAKMCPYFHQLE 121
                         8********************************************************************97.99999********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.05E-2336101No hitNo description
PROSITE profilePS500907.0853794IPR017877Myb-like domain
PfamPF138371.8E-1937122No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MQHHIEALIA SMQPVVAGRL GGGESNGGNN NESGMPRWPK EEVDALIWLR MEKDELCQDL  60
GGKGQLWDDI SAGMRNMGYH RSSKRCKEKW ENINKYFKKV KESKKRRPQD AKMCPYFHQL  120
EDIYRKRQQF TMSGSGGSSS IAPGDTMVTV SEQAVLEQEN HQCELQGNIG DDFGMMGNDR  180
GGNSDAPSCN NGDTAMDTTV LDDNAINEEE NPQRELEDKI NNDLSMVENT EGKNLDTPPS  240
NGGDTTMDTV VLDDRSINKV EDKINNDLGM VENTERKNLD TPPSNGGDTA MDTVVLDDCS  300
INKEENPQRE LEVKIKNNLS IMGNGGGGDN LLAPLRNGGD TPMDINVVDN MVKNKQENPM  360
REFEGKISNN CSMMDNGGGD NLHAPLSNDD TTGDTTVLDE STINIEENLL APPCNVGKMA  420
IDTAMLDESA INEENPSCEL ENKISIDFNK MDNGEGENLL SQPSNCDDTA VDTTMLDESA  480
INKDENHWCE LEGNINNDFG MMGNKGGENL IAAPNDGGDT TIDTTVLDDN TVNNEQNPPR  540
DLEGKISTDF AMMINGGGEN LLPHQEVGTI P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235774.11e-112PREDICTED: beclin-1-like protein A
TrEMBLA0A0Q3IJ981e-123A0A0Q3IJ98_BRADI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-37Trihelix family protein