PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G039200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRF
Protein Properties Length: 414aa    MW: 44801.6 Da    PI: 7.8238
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G039200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.91e-2487130144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Brast04G039200.1.p  87 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 130
                         79***************************************998 PP

2QLQ62.79.8e-221550237
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        +FTa+Q+q+L++Q+l+yKy+a+++P+P++Ll+++++
  Brast04G039200.1.p 15 PFTATQWQELEHQALIYKYMASGVPIPSDLLLPLRR 50
                        9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-111450IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-151548IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4251550IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57387131IPR014977WRC domain
PfamPF088792.3E-2088130IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MMMLGGRAAG GGRCPFTATQ WQELEHQALI YKYMASGVPI PSDLLLPLRR SFLFDSALAA  60
SPSLAFSPQS SLGWGCFGMG FGRKAEDPEP GRCRRTDGKK WRCSKEAYPD SKYCEKHMHR  120
GKNRSRKPVE MSLATPPPPS SSSSSLSASS SSANASSAAI NAAATTTSAA AGAHSYHHHH  180
RHDPASPYTH HALYGRNQQL AAAGGYQVSG SPFHLHLDTT HPHPPPSYYS ASAMDHHHAY  240
GHTVLKEPPP AHGGEHAFFS NSDSHATDRP SSDHVHGWQF KQLGMDPHHK QLHNSTPVLF  300
PGGGYGNGNG AAYAIDLCKE DDEEKERRQQ QQHCFLLGAD LRLDKPSSQH DGTQAKPLRP  360
FFDEWPHENK GGGGKAGSWM GLDGETQLSI SIPMASAAND LPITTTSRYH HGE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1411GGRAAGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast04G039200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3538131e-149AK353813.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002P02.
GenBankAK3564091e-149AK356409.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1034G13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570521.10.0growth-regulating factor 1
SwissprotQ6AWY81e-148GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLI1IEL90.0I1IEL9_BRADI; Uncharacterized protein
STRINGBRADI3G57267.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-46growth-regulating factor 5