PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G297200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 469aa    MW: 49965.2 Da    PI: 7.7833
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G297200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.92.9e-10322373556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +
  Brast03G297200.1.p 322 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDS 373
                         899*****************************************99998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-18318382IPR004827Basic-leucine zipper domain
PfamPF077163.2E-9319371IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.726320383IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.82E-12322372No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-11322378No hitNo description
CDDcd147039.19E-22323372No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MDDSGGADPA RQHQYQHPHQ PQQQQLASPQ QGGAAPVPRS PTPLDLAAYH RRLSASPRPP  60
AHPQACARLP SPYGGGGGSG QIPSGGGHAR SLSQPLFFSL DSLPPPPYAD LAAARSPPSS  120
TSDPPPFGLP PRRAAAGGHR RSHSDIPFGG FSSQLSPPLP PPAPVKREEG GRSGDDAALY  180
DLVNAYMDLD GMDALNSDDR DDSRASGTRA GSAAESSENE AESQSTSAQR MDGGGKSRHC  240
RSLSMDSFMG KLNFAAGDES PKLPLPSSSG AGLSRSGSGS LDGGGAAALF GTEFANGEFS  300
EAEKKKIMAN ERLAEIALTD PKRVKRILAN RQSAARSKER KMRYIQELEH KVQVLQTEAT  360
TLSAQLTMLQ RDSGGLATQN NELKIRLQAM EQQAQLRDAL NEALTGEVQR LKLATGETSD  420
ARMSKMGLQQ QMNSQLIQMQ QLQIQQQQQQ PQTQQAQQQQ QSQSQQSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G297200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9843780.0GU984378.1 Triticum aestivum cultivar CB037 bZiP-like trancription factor (SF) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574872.10.0transcription factor RF2a
TrEMBLI1I9660.0I1I966_BRADI; Uncharacterized protein
STRINGBRADI3G41980.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-69bZIP family protein