PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G289700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 119aa    MW: 13950.9 Da    PI: 10.4535
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G289700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.45.3e-253482250
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        rie+   rqv fskRr g++KKA+ELSvLCd+eva+++fs+ g++y + 
  Brast03G289700.1.p 34 RIEDRASRQVRFSKRRSGLFKKAFELSVLCDVEVALLVFSPAGRIYQFV 82
                        8*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-312584IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.3992585IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-2727100IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-262747IPR002100Transcription factor, MADS-box
PfamPF003191.4E-253481IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-264762IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-266283IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MEEERRRRML QEKEAAHGHG GKERKKRGRV ELRRIEDRAS RQVRFSKRRS GLFKKAFELS  60
VLCDVEVALL VFSPAGRIYQ FVSSETSVEE IFGRCRDLPN AVNDLHIQVR DPRVDQDIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-172785361Myocyte-specific enhancer factor 2B
1tqe_Q3e-172785361Myocyte-specific enhancer factor 2B
1tqe_R3e-172785361Myocyte-specific enhancer factor 2B
1tqe_S3e-172785361Myocyte-specific enhancer factor 2B
6c9l_A3e-172785361Myocyte-specific enhancer factor 2B
6c9l_B3e-172785361Myocyte-specific enhancer factor 2B
6c9l_C3e-172785361Myocyte-specific enhancer factor 2B
6c9l_D3e-172785361Myocyte-specific enhancer factor 2B
6c9l_E3e-172785361Myocyte-specific enhancer factor 2B
6c9l_F3e-172785361Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1526RRRMLQEKEAAHGHGGKERKKR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G289700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693361e-102KF469336.1 Brachypodium distachyon MADS-box transcription factor 42 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288324.18e-61MADS-box transcription factor 7-like
SwissprotQ9XJ611e-30MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBLI1I8X72e-59I1I8X7_BRADI; MADS-box transcription factor 42
STRINGBRADI3G41297.13e-60(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.15e-24AGAMOUS-like 14
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SL,Lee S,Kim HJ,Nam HG,An G
    OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a.
    Plant Physiol., 2007. 145(4): p. 1484-94
    [PMID:17951465]