PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G277200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 1127aa    MW: 123056 Da    PI: 7.0983
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G277200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.1e-41187264178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv++C+adl++ak+yhrrhkvCe+hsk+++++v +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Brast03G277200.1.p 187 MCQVDDCRADLTSAKDYHRRHKVCEIHSKTTKAVVGNQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 264
                         6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-34180249IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12185262IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.98E-38186265IPR004333Transcription factor, SBP-box
PfamPF031108.9E-30188261IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1127 aa     Download sequence    Send to blast
MQREVGPQVA SPLYLHHQIQ PLPPHAAAAP KKRGNPWPAS AEGAAAGSAG AGNWNPAMWD  60
WDSRAFTARP SSDALRLGAG AQNHHQHQHQ QQQRQPAAAA MAAEAQRQGP GGLSLQLATR  120
EEASMAMDVS PTATMSSSPS PPAAPAQEQP ARPSKKVRSE SPGTGSGGAG GNGGGGSGGN  180
GGASYPMCQV DDCRADLTSA KDYHRRHKVC EIHSKTTKAV VGNQMQRFCQ QCSRFHPLSE  240
FDEGKRSCRR RLAGHNRRRR KTQPTDVASQ LLLPENQENA GNRTQDIVNL ITVIARLQGG  300
NVGKLPSIPP IPDKDNLVQI ISKINSINTA NALGKSPPSE VIDLNASHGQ QQDTVQKATN  360
VIDKQAVPST MDLLTVLSGG NGASTPETNT SQSQGSSDSS GNNKSKSHST EPAFVVNSHE  420
KSIRAFPAAG VVRSNSPHDS PPEMYKQPDR DARPFLSLQL FGSTYDDIPA KMDTANKYLS  480
SESSNPMDER SPSSSPPVTH TFFPIRSAND GITHPRGADY GEDAATVENS TTRAWCAPPL  540
ELFKDSERPT ENGSPPNLTY QSCYASTSGS DHSPSTSNSD GQDRTGRIIF KLFGKEPGSI  600
PGNLRDEVVN WLKHSPSEME GYIRPGCLVL SMYLSMPAIA WDELEENLLH RVNTLIQGSD  660
SDFWRNGRFL VRSDNQLVSY KDGTTRLSKS WRTWNTPELT LVTPIAVVGG RKSSLVLKGR  720
NLTIPGTQIH CTTEGKYISK EVLCSAYPGT IYDDSGVETF DLPGEPNLIL GRCFIEVENR  780
FRGNSFPVIF ANSNICQELR NLETELEDSR FPDVSSEDQV DDTRRLKPRD QVLHFLNELG  840
WLFQKAAACI PSTKSDVSDS ELIQFSTARF RYLLLFSNER DWCSLTKTLL DILSKRSLVS  900
DELSQETLEM LSEIHLLNRA VKRKSRRMVH LLVQFVVICP DNSKLYPFPP NYPGPGGLTP  960
LHLAASIDDA EGVVDALTDD PQQIGLNCWH SVLDDDGQSP EAYAKFRNND SYNDLVAQKL  1020
VDKKNSQVTI ILNKGEICMD QPGNGGENNA SGIQAMEIKS CSQCAILESG LLRRPMHSRG  1080
LLARPYIHSM LAIAAVCVCV CVFMRALLRF NSGRSFKWER LDFGTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-33178261184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G277200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574766.10.0squamosa promoter-binding-like protein 15 isoform X1
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
TrEMBLI1I8J30.0I1I8J3_BRADI; Uncharacterized protein
STRINGBRADI3G40240.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14