PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G265300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 377aa    MW: 41099.2 Da    PI: 5.084
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G265300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.65.2e-26958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nr+vtfskRrng++KKA+ELSvLCd+++a+++fs++ +l  +s
  Brast03G265300.1.p  9 KRIENTTNRHVTFSKRRNGLIKKAYELSVLCDIDIALLMFSPSKRLCPFS 58
                        79*****************************************9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.6E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.74161IPR002100Transcription factor, MADS-box
CDDcd002652.63E-32272No hitNo description
SuperFamilySSF554551.57E-27282IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-23323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004047.8E-233859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRVKLPIKR IENTTNRHVT FSKRRNGLIK KAYELSVLCD IDIALLMFSP SKRLCPFSGR  60
HGVEDVLLRY LNMTDHDRGE PIQNREYLIS MLQRLKRESD MATQLANPGA LNEKIEEIQQ  120
EIYGSQQQLQ ISEERLRLFE PDPAAFGSAS EIDGCEKFLM DMLTRVVERK NYLLSNHMAP  180
FDPTAPGMQG ASGPQMYAHH QHHPGQQQQQ QQGPGEGGVG GGLVGPFAAS DAAALWASDP  240
GGGPNTAHHH HLFAASSDPM MYLRDQDVYE AAAASSDQQQ QAEAWRQAYT CTELLSTLIP  300
ATPFPLMQHC LGPDDGDPYG LPAPGMATTM QQQQESLEAS ASCSYTMPTS DETAGTPPVL  360
QPAAFDAAAM PPGGIP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A3e-17197190MEF2 CHIMERA
6bz1_B3e-17197190MEF2 CHIMERA
6bz1_C3e-17197190MEF2 CHIMERA
6bz1_D3e-17197190MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G265300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693351e-118KF469335.1 Brachypodium distachyon MADS-box transcription factor 41 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233634.10.0agamous-like MADS-box protein AGL11-like isoform X1
TrEMBLA0A0Q3HZ210.0A0A0Q3HZ21_BRADI; Uncharacterized protein
STRINGBRADI3G39177.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.17e-75AGAMOUS-like 66