PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G261600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 219aa    MW: 23886.5 Da    PI: 8.3958
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G261600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.23.1e-12103156356
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         e +r rr+ +NRe+ArrsR RK+ ++ eL  +v+ L + N++L +el++    +
  Brast03G261600.1.p 103 EERRRRRMVSNRESARRSRMRKQRQLSELWARVAHLRSANRRLLDELNRALRAC 156
                         66899******************************************9866555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-10101165IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-8102154No hitNo description
PfamPF001702.6E-9103151IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542103151IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.97E-10105153No hitNo description
PROSITE patternPS000360108123IPR004827Basic-leucine zipper domain
CDDcd147028.91E-15110157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MYHHNHGEVA SLHFLLPPNN PSSSFTTHHH MNMALPPQAY FPPSFDQSPA LLAGNDTEAS  60
FEFETILEEA AQLVSRGNGS PSSGSDGGGG NCCYQEGSAA AAEERRRRRM VSNRESARRS  120
RMRKQRQLSE LWARVAHLRS ANRRLLDELN RALRACADAC RESARLRDEK TKLTEKLEQL  180
LKQPAPEKTA SSNNHSSCSS EPCKNSATAA AAAAGVTE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117124RRSRMRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G261600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0043769e-58AP004376.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0481F05.
GenBankAP0045579e-58AP004557.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0028A08.
GenBankAP0149649e-58AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126169e-58CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankCT8315049e-58CT831504.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA115A07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572318.11e-103bZIP transcription factor 11
TrEMBLI1I8321e-102I1I832_BRADI; Uncharacterized protein
STRINGBRADI3G38840.11e-102(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.11e-08basic leucine-zipper 58