PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G221100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family LBD
Protein Properties Length: 397aa    MW: 42804.6 Da    PI: 4.3351
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G221100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.22.9e-3869167199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC++dC+lapyfpa+q+++f n+h+lFG+sn+lk+l+++++e  ++am++l+y+Ae+ra dPv G+++vi++l++  e ++
  Brast03G221100.1.p  69 ACAACKYQRRKCNPDCPLAPYFPADQQRRFLNAHRLFGVSNILKTLRRIKPELCDAAMHALIYQAEMRAMDPVGGCYRVIFDLENTFELES 159
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         aela+l +
  Brast03G221100.1.p 160 AELAALLH 167
                         **998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.03668169IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-3669164IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MTSSSSAASS LHITITSNPS STITNNTNAN NPKPQQQQQQ HPSQGSARPG SNNNGSSGGS  60
SGSSSTNQAC AACKYQRRKC NPDCPLAPYF PADQQRRFLN AHRLFGVSNI LKTLRRIKPE  120
LCDAAMHALI YQAEMRAMDP VGGCYRVIFD LENTFELESA ELAALLHHLD LCRQAAAAAT  180
AVPPHDVMDA ADLDLEVTSS NHQPGLAMDA AVVDVDTLYV AQEDDNNADH GNNNNNSSSP  240
PQDHGGQQQK LYDYFYYETT NNAAGAPEDA SSNKTGSVDI NVDVMQHFDY DSGCDAIDDH  300
SHKLAVELAP MMSSCGLVGQ QHQLEEEHYG QIDQKEYEMK VASFVDAFDV NADIAASVKE  360
EIDDQEEDAN NNMALAEQSQ LAESSHCTLG LGFSSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-227018312123LOB family transfactor Ramosa2.1
5ly0_B9e-227018312123LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G221100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-100HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572169.10.0LOB domain-containing protein 20
TrEMBLI1I6U60.0I1I6U6_BRADI; Uncharacterized protein
STRINGBRADI3G35280.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.17e-34LOB domain-containing protein 22