PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G181400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 403aa    MW: 43021.8 Da    PI: 7.4078
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G181400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.58e-10249306562
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         kr +r   NR +A rs +R+  +i+eLe kv+ L++e ++L  +l +l+   + l ++
  Brast03G181400.1.p 249 KRVKRVLANRQSAARSKERRMRYIAELEHKVQILQTEATTLSAQLTHLQRDTSGLATQ 306
                         999********************************************99887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-16245309IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783247310IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.03E-11249300No hitNo description
PfamPF001703.8E-9249307IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.1E-11249306No hitNo description
CDDcd147035.13E-23250299No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MMNTTNETMH RHVQAAAVLP FAAGGGRGMA PAHGGKQRAG LPPTAPPSSG SHPLHASVQM  60
QQQDGPLPPR KAHRRSRSDV PFGYFPPPSP KTESAGSWGS LPCAGGDDLF SAYMSMEGMD  120
SAGLSNNNSS DGEYSRGSSV PAAGNGADSS ENESEDYGGG GEGQVFLWGG DAGGKKRNAA  180
GEAAAAGRHA RSLSMDSLMG RLSFSGANGS GEPGKLFSLE FGSGEFTPAE MKRIMADEKL  240
AEMALADPKR VKRVLANRQS AARSKERRMR YIAELEHKVQ ILQTEATTLS AQLTHLQRDT  300
SGLATQNNEL KFRLQAMEQQ AQLRDALNEA LTGEVQRLKL SATTSELGDG GSSSDLAQKM  360
QLRCQNQMLE LHKQQQQQQQ IPFYQLEQPE QNGAASRTHE SK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G181400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574243.20.0transcription factor RF2b
TrEMBLA0A0Q3IB960.0A0A0Q3IB96_BRADI; Uncharacterized protein
STRINGBRADI3G31890.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-78bZIP family protein