PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G169600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Trihelix
Protein Properties Length: 767aa    MW: 82146.1 Da    PI: 6.0167
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G169600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix98.46.4e-3184168187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r++m+ ++r++ lk+plWeevs+k++e+g++r++k+Ckek+en++k+yk++k+++ +r  ++ +t+++f+qlea
  Brast03G169600.1.p  84 RWPRQETLALLKIRSDMDAAFRDATLKGPLWEEVSRKLAEEGYRRNAKKCKEKFENVHKYYKRTKDSRAGR--NDGKTYRFFQQLEA 168
                         8********************************************************************97..56668*******85 PP

2trihelix109.61.9e-34451536187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k ev+aLi++r+++++r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
  Brast03G169600.1.p 451 RWPKAEVHALIQLRSNLDTRYQEAGPKGPLWEEISAGMRRMGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 536
                         8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.01981143IPR001005SANT/Myb domain
PfamPF138373.2E-2183169No hitNo description
CDDcd122035.47E-2883148No hitNo description
PROSITE profilePS500906.56283141IPR017877Myb-like domain
PROSITE profilePS500907.41444508IPR017877Myb-like domain
SMARTSM007170.0053448510IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-4450507IPR009057Homeodomain-like
PfamPF138373.2E-23450537No hitNo description
CDDcd122039.96E-29450515No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 767 aa     Download sequence    Send to blast
MQQHQGGGGQ FGLHPPEMPP FSPAGQRISM AEAPSPISSR PPAPPGQQQL SSNELAGAAA  60
AMGFDEEALA AGEEGGGGGS GGNRWPRQET LALLKIRSDM DAAFRDATLK GPLWEEVSRK  120
LAEEGYRRNA KKCKEKFENV HKYYKRTKDS RAGRNDGKTY RFFQQLEALQ GAPGAGAGAS  180
SVPPPAAAVR APAEPPPQQP VVATGAMPMG VGNLSFSTSN TEEFSEEEEE EEDSDDEGTD  240
DMAVGGKRKR LSSDGGASGG KNSKKMMRFF EGLMRQVMER QEAMQQRFLE AIEKREQDRM  300
IREEAWRRQE MARLAREQEI LAQERAMAAS RDAAVLGFIQ KITGQPVPMP MPPMAPPPSV  360
AFMPPSSHPA PISFSAAPPS SQPPSQSPRP QKPPMPLATP APQKTPPVPA TPPPPPPQQQ  420
QQQQGSGGME MVAVAAGELQ AHDGGSASSS RWPKAEVHAL IQLRSNLDTR YQEAGPKGPL  480
WEEISAGMRR MGYSRSSKRC KEKWENINKY FKKVKESNKK RPEDSKTCPY FHQLEALYRN  540
KQAAAAPLPL AAPPPPPPEL TVAAPISQTP PPHASQQQQP AAKNGAGNGH GNGNGSGVAG  600
SEGGGVSAGA VQMQASNGFF GEAGAVAGKK PEAMMKETIV LEQQQRQQPQ AAPISSSYNN  660
RAGVDSDNSM DDEDDYDDED EDDDDEDDVD GNKMQYEIQF QSQQQQQQQQ HHQLHQQHHQ  720
HNNHNVVRPN AGAAGGGNQP GGAAPPSAAS AAAATTTAGS FLGMVQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3727131e-126AK372713.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010E21.
GenBankAK3615071e-126AK361507.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1142F04.
GenBankAK3544261e-126AK354426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1007E05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574172.10.0PREDICTED: trihelix transcription factor GTL1 isoform X1
RefseqXP_010234894.10.0PREDICTED: trihelix transcription factor GTL1 isoform X1
TrEMBLI1I5990.0I1I599_BRADI; Uncharacterized protein
STRINGBRADI3G30457.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-51Trihelix family protein