PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G099700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 188aa    MW: 20707.2 Da    PI: 9.5713
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G099700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.95.8e-153797363
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        +lkr rrk++NRe+A+rsR+RK++++eeL++ v +L +e ++L  +l+   + +a+ ++++
  Brast03G099700.1.p 37 DLKRKRRKESNRESAKRSRLRKQQQLEELTTQVNQLRTEKQQLVTTLNLTMQSYAAAETQN 97
                        69**********************************************9999998877766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-113284No hitNo description
SMARTSM003382.4E-153599IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8873779IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.56E-103891No hitNo description
PfamPF001702.1E-113892IPR004827Basic-leucine zipper domain
CDDcd147029.94E-184091No hitNo description
PROSITE patternPS0003604257IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MMSLSGGTLS SETLSGSSHG TQSYGSEGNL ELQARMDLKR KRRKESNRES AKRSRLRKQQ  60
QLEELTTQVN QLRTEKQQLV TTLNLTMQSY AAAETQNSVL RSQAMELESH LRALREIIYY  120
LNSASTQFSI PTAAAAAQTT AAAYYPTTSL MASAAASYDV AGANAWGSGM QMLQQQQQPI  180
ELMYHRC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13843KRKRRK
23944RKRRKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G099700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571697.11e-115bZIP transcription factor 44
TrEMBLI1I3841e-114I1I384_BRADI; Uncharacterized protein
STRINGBRADI3G22040.11e-115(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-15basic leucine-zipper 44