PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G064000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 236aa    MW: 25516.8 Da    PI: 7.7616
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G064000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.19.9e-162787257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        r+R+++++eq+ +Le+ F++   +p ++e +++ + l     + +++V++WFqNrR + ++
  Brast03G064000.1.p 27 RSRWAPKPEQILILESIFNSgMVNPAKDETARIRRLLerfgAVRDANVFYWFQNRRSRSRR 87
                        89*****************99*************************************997 PP

2Wus_type_Homeobox105.24.3e-342688264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        ar+RW+P+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++
  Brast03G064000.1.p 26 ARSRWAPKPEQILILESIFNSGMVNPAKDETARIRRLLERFGAVRDANVFYWFQNRRSRSRRR 88
                        689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.4022388IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-82493IPR009057Homeodomain-like
SMARTSM003892.2E-52592IPR001356Homeobox domain
SuperFamilySSF466899.41E-132594IPR009057Homeodomain-like
PfamPF000461.7E-132787IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MDHHSQAATP SQRAGCGEGA DQPAAARSRW APKPEQILIL ESIFNSGMVN PAKDETARIR  60
RLLERFGAVR DANVFYWFQN RRSRSRRRAR QLQLQHQLQL PSAHGGVTQY AGVSSAAAPV  120
ASAPAAATVA PHLLADVVGA GDDDLFAIPR QMGLMDHRYT DTSQLTYQQP GTIQVFINGA  180
AYEVPSAGAL DLAGTFGHDV ILVHSSGEIL PVNEHGVLMK NLQMGECYYM VSRSI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126166e-96CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankAP0149646e-96AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0052496e-96AP005249.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0087F21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571573.11e-120PREDICTED: WUSCHEL-related homeobox 10-like
SwissprotA2YST14e-85WOX10_ORYSI; WUSCHEL-related homeobox 10
SwissprotQ6Z3L44e-85WOX10_ORYSJ; WUSCHEL-related homeobox 10
TrEMBLI1I2851e-120I1I285_BRADI; Uncharacterized protein
STRINGBRADI3G18800.11e-120(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.18e-28WUSCHEL related homeobox 11