PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G062800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family M-type_MADS
Protein Properties Length: 221aa    MW: 25093 Da    PI: 10.2817
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G062800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.13.1e-201664149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        k i ++  r+v fskRr+g++ KA+ELS+LC+a+va+++fs+ gk++ +
  Brast03G062800.1.p 16 KAIHSEKARHVCFSKRRQGLFSKANELSTLCGADVAIVVFSPGGKIFSF 64
                        579999***************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.404868IPR002100Transcription factor, MADS-box
SMARTSM004325.1E-30867IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.11E-26985IPR002100Transcription factor, MADS-box
CDDcd002651.14E-30984No hitNo description
PRINTSPR004042.0E-181030IPR002100Transcription factor, MADS-box
PfamPF003194.4E-241864IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MVKGKTTKGR RKIEIKAIHS EKARHVCFSK RRQGLFSKAN ELSTLCGADV AIVVFSPGGK  60
IFSFGNPSVD SIIHRFLPKS TNDAHAMVGG SNQIHVDPNN SRALSQEYSN LQMMMEAEQK  120
RKKRIQEEME RESYGRVMRW LNTDVTALRL DELEEFHREL TVLDCMVNGR LYWLLQQAKT  180
MKKTLPQTHS KEMSTAQFMC PVKTVMPMSS TPFSSTNGIH G
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast03G062800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693440.0KF469344.1 Brachypodium distachyon MADS-box transcription factor 50 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663982.14e-52agamous-like MADS-box protein AGL29
TrEMBLA0A0Q3F7I41e-138A0A0Q3F7I4_BRADI; Uncharacterized protein
TrEMBLI1I2691e-139I1I269_BRADI; MADS-box transcription factor 50
STRINGBRADI3G18670.11e-139(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36590.18e-32M-type_MADS family protein