PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G372100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family SBP
Protein Properties Length: 964aa    MW: 104871 Da    PI: 5.1691
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G372100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.17e-40156233178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +CqvegC adl+ ak+yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Brast02G372100.1.p 156 ACQVEGCCADLTAAKDYHRRHKVCEMHAKANTAVVGNTVQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNRRRRKTRP 233
                         5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-33149218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.274154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-37155235IPR004333Transcription factor, SBP-box
PfamPF031101.3E-28157230IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.8E-8724848IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.5E-7745849IPR020683Ankyrin repeat-containing domain
CDDcd002041.79E-8747847No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 964 aa     Download sequence    Send to blast
MEAAGVGSQS RQLYGGGLGE PAQDMRGKRL FGWDLNDWSW DSERFVATPA PAAAAVANGL  60
SLNSSPSSSE EVDVEVAGSG NVRGGSDKRK RVVVIDDDDV DEKDEDPVDN DGRVLSLRTG  120
GDTTVAGGAV EGGVVNEEDR NGKKIRVQGG SSSGPACQVE GCCADLTAAK DYHRRHKVCE  180
MHAKANTAVV GNTVQRFCQQ CSRFHLLQEF DEGKRSCRRR LAGHNRRRRK TRPEIAVGGT  240
PIEDKVGSYL LLSLLGICAN LNSENAEHLQ GQELLSNLWR NLGTVAKSLD PKELCKLLET  300
CQSMQHGSNT GTSEAANALV NTAAAEAAGP SNSKAPFTNG GQREQTSSAV IPVQSNATVV  360
ATPETPACRI RNFDLNDTCN DMEGFEDGSN CPSVQQDSTQ SPPQTSGNSD STSAQSLSSS  420
NGDAQCRTDK IVFKLFDKVP SDLPPILRSQ ILGWLSSSPT DIESYIRPGC IILTVYLRLV  480
DTAWRELSEN MSLYLDKLLS SSTDNFWASG LVFVMVRHQI VFMHNGQVML DRPLAPNSHH  540
YCKVLCVSPV AAPSSATVNF RVEGFNLVSA SSRLICSFEG RCIFQEDTAI VDDDAEHEDI  600
ECLNICCSLP GSRGRGFIEV EDSGFSNGFF PFIVAEQDVC SEVCELESIF KSSSHEQADN  660
DNARSQALEF LNELGWLLHS ANIISKHDKV ELPLAAFNLL RFRNLGIFAM EREWCAVTKV  720
LLDLLFDGFV DVGLQSPKEV VLSENLLHTA VRGKSVRMVR FLLRYKPSKD QKEIAEAYLF  780
RPDARGPSTF TPLHIAAATS DAEDVLDALT SDPGLVGLNA WKNARDETGF TPEDYARQRG  840
NDAYMNLVQK KIDKHLGEGH VVLGVPSSMC PVLTDGAKPG DISLEICKSM PMAPQPASSC  900
NICSRQARMY PSSFANTFLY RPAMFTVMGV AVICVCVGIL LHTLPKVYAA PNFRWELLER  960
GPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-30150230484squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapBrast02G372100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478800.0KF447880.1 Triticum aestivum squamosa promoter-binding-like protein 6 (SPL6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563064.10.0squamosa promoter-binding-like protein 6
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLI1GL800.0I1GL80_BRADI; Uncharacterized protein
STRINGBRADI1G02760.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]